SON Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16323
Artikelname: SON Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16323
Hersteller Artikelnummer: A16323
Alternativnummer: ABB-A16323-20UL,ABB-A16323-100UL,ABB-A16323-500UL,ABB-A16323-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SON3, BASS1, DBP-5, NREBP, TOKIMS, C21orf50, SON
This gene encodes a protein that contains multiple simple repeats. The encoded protein binds RNA and promotes pre-mRNA splicing, particularly of transcripts with poor splice sites. The protein also recognizes a specific DNA sequence found in the human hepatitis B virus (HBV) and represses HBV core promoter activity. There is a pseudogene for this gene on chromosome 1. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 264kDa
NCBI: 6651
UniProt: P18583
Reinheit: Affinity purification
Sequenz: TMDSQMLATSSMDSQMLASGTMDSQMLASGTMDAQMLASGTMDAQMLASSTQDSAMLGSKSPDPYRLAQDPYRLAQDPYRLGHDPYRLGHDAYRLGQDPYR
Target-Kategorie: SON
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cancer,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using SON Rabbit pAb (A16323) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 8min.