GANC Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16377
Artikelname: GANC Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16377
Hersteller Artikelnummer: A16377
Alternativnummer: ABB-A16377-100UL,ABB-A16377-20UL,ABB-A16377-1000UL,ABB-A16377-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GANC
Glycosyl hydrolase enzymes hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. This gene encodes a member of glycosyl hydrolases family 31. This enzyme hydrolyses terminal, non-reducing 1,4-linked alpha-D-glucose residues and releases alpha-D-glucose. This is a key enzyme in glycogen metabolism and its gene localizes to a chromosomal region (15q15) that is associated with susceptibility to diabetes. Alternative splicing results in multiple transcript variants encoding different isoforms.
Klonalität: Polyclonal
Molekulargewicht: 104kDa
NCBI: 2595
UniProt: Q8TET4
Reinheit: Affinity purification
Sequenz: DVLTSKPSTVRLISCSGDTGSLILADGKGDLKCHITANPFKVDLVSEEEVVISINSLGQLYFEHLQILHKQRAAKENEEETSVDTSQENQEDLGLWEEKFG
Target-Kategorie: GANC
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using GANC Rabbit pAb (A16377) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.