UBE2E2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A16441
- Bilder (1)
| Artikelname: | UBE2E2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A16441 |
| Hersteller Artikelnummer: | A16441 |
| Alternativnummer: | ABB-A16441-100UL,ABB-A16441-20UL,ABB-A16441-1000UL,ABB-A16441-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | UBCH8, UBE2E2 |
| Enables ISG15 transferase activity and ubiquitin conjugating enzyme activity. Involved in protein modification by small protein conjugation. Acts upstream of or within cellular response to DNA damage stimulus and positive regulation of G1/S transition of mitotic cell cycle. Predicted to be active in nucleus. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 22kDa |
| NCBI: | 7325 |
| UniProt: | Q96LR5 |
| Reinheit: | Affinity purification |
| Sequenz: | MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT |
| Target-Kategorie: | UBE2E2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using UBE2E2 Rabbit pAb (A16441) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 180s. |
Produktgarantie und fachkundiger Support
