PPFIBP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A16456
- Bilder (1)
| Artikelname: | PPFIBP1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A16456 |
| Hersteller Artikelnummer: | A16456 |
| Alternativnummer: | ABB-A16456-20UL,ABB-A16456-100UL,ABB-A16456-500UL,ABB-A16456-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | L2, SGT2, hSGT2, hSgt2p, NEDSMBA, PPFIBP1 |
| The protein encoded by this gene is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis. In vitro experiment demonstrated that the interaction inhibited the phosphorylation of this protein by protein kinase C and protein kinase CK2. Alternatively spliced transcript variants encoding distinct isoforms have been reported. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 114kDa |
| NCBI: | 8496 |
| UniProt: | Q86W92 |
| Reinheit: | Affinity purification |
| Sequenz: | LLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVKPKKLAFSNFGNLRKKKQEDGEEYVCPMELGQASGSASKKGFKPGLDMRLYEEDDLDRLEQMEDSEGTVRQIGAFSEGINNLTHMLKEDDMFKDFAARSPSASITDEDSNV |
| Target-Kategorie: | PPFIBP1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using PPFIBP1 Rabbit pAb (A16456) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
