RAB38 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16505
Artikelname: RAB38 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16505
Hersteller Artikelnummer: A16505
Alternativnummer: ABB-A16505-20UL,ABB-A16505-100UL,ABB-A16505-500UL,ABB-A16505-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: rrGTPbp, NY-MEL-1, RAB38
Enables several functions, including AP-1 adaptor complex binding activity, AP-3 adaptor complex binding activity, and BLOC-2 complex binding activity. Involved in several processes, including endosome to melanosome transport, melanosome assembly, and phagosome acidification. Located in several cellular components, including cytoplasmic vesicle, lysosome, and mitochondria-associated endoplasmic reticulum membrane.
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 23682
UniProt: P57729
Reinheit: Affinity purification
Sequenz: VTRPATFEAVAKWKNDLDSKLSLPNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAKS
Target-Kategorie: RAB38
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins. Shipping: Ice Bag
Western blot analysis of various lysates using RAB38 Rabbit pAb (A16505) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.