GPR82 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16516
Artikelname: GPR82 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16516
Hersteller Artikelnummer: A16516
Alternativnummer: ABB-A16516-20UL,ABB-A16516-100UL,ABB-A16516-500UL,ABB-A16516-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GPR82
The protein encoded by this gene is an orphan G protein-coupled receptor of unknown function. The encoded protein is a member of a family of proteins that contain seven transmembrane domains and transduce extracellular signals through heterotrimeric G proteins.
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 27197
UniProt: Q96P67
Reinheit: Affinity purification
Sequenz: MNNNTTCIQPSMISSMALPIIYILLCIVGVFGNTLSQWIFLTKIGKKTSTHIYLSHLVTANLLVCSAMPFMSIYFLKGFQWEYQSAQCRVVNFLGTLSMH
Target-Kategorie: GPR82
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR. Shipping: Ice Bag
Western blot analysis of various lysates using GPR82 Rabbit pAb (A16516) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.