ADIPOR1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A16527
- Bilder (1)
| Artikelname: | ADIPOR1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A16527 |
| Hersteller Artikelnummer: | A16527 |
| Alternativnummer: | ABB-A16527-100UL,ABB-A16527-20UL,ABB-A16527-500UL,ABB-A16527-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CGI45, PAQR1, ACDCR1, CGI-45, TESBP1A, ADIPOR1 |
| This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 43kDa |
| NCBI: | 51094 |
| UniProt: | Q96A54 |
| Reinheit: | Affinity purification |
| Sequenz: | MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETG |
| Target-Kategorie: | ADIPOR1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,AMPK Signaling Pathway,Cardiovascular,Lipids. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ADIPOR1 Rabbit pAb (A16527) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates / proteins: 25 µg per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time:30s. |
Produktgarantie und fachkundiger Support
