PTHLH Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A1654
- Bilder (1)
| Artikelname: | PTHLH Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A1654 |
| Hersteller Artikelnummer: | A1654 |
| Alternativnummer: | ABB-A1654-100UL,ABB-A1654-20UL,ABB-A1654-500UL,ABB-A1654-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HHM, PLP, BDE2, PTHR, PTHRP, PTHLH |
| The protein encoded by this gene is a member of the parathyroid hormone family. This hormone, via its receptor, PTHR1, regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is responsible for most cases of humoral hypercalcemia of malignancy, and mutations in this gene are associated with brachydactyly type E2 (BDE2). Alternatively spliced transcript variants have been found for this gene. There is also evidence for alternative translation initiation from non-AUG (CUG and GUG) start sites, downstream of the initiator AUG codon, resulting in nuclear forms of this hormone. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 20 kDa |
| NCBI: | 5744 |
| UniProt: | P12272 |
| Reinheit: | Affinity purification |
| Sequenz: | RSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR |
| Target-Kategorie: | PTHLH |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:4000 - 1:8000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Growth factors. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using PTHLH Rabbit pAb (A1654) at 1:8000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90 s. |
Produktgarantie und fachkundiger Support
