LIN7C Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16544
Artikelname: LIN7C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16544
Hersteller Artikelnummer: A16544
Alternativnummer: ABB-A16544-100UL,ABB-A16544-20UL,ABB-A16544-1000UL,ABB-A16544-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MALS3, VELI3, LIN-7C, MALS-3, LIN-7-C, LIN7C
Enables L27 domain binding activity and cytoskeletal protein binding activity. Involved in morphogenesis of an epithelial sheet. Located in cell-cell junction, cytoplasm, and plasma membrane. Part of MPP7-DLG1-LIN7 complex.
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 55327
UniProt: Q9NUP9
Reinheit: Affinity purification
Sequenz: MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVR
Target-Kategorie: LIN7C
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Tight Junctions,Cytoskeleton,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using LIN7C Rabbit pAb (A16544) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.