NRN1L Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16594
Artikelname: NRN1L Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16594
Hersteller Artikelnummer: A16594
Alternativnummer: ABB-A16594-100UL,ABB-A16594-20UL,ABB-A16594-1000UL,ABB-A16594-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: UNQ2446, cpg15-2, MRCC2446, NRN1L
The protein encoded by this gene is extracellular and enhances both neurite growth and neuronal survival. The encoded protein is found both as a GPI anchored membrane-bound form and as a secreted form. This activity-related ligand functions as a homodimer or heterodimer.
Klonalität: Polyclonal
Molekulargewicht: 18kDa
NCBI: 123904
UniProt: Q496H8
Reinheit: Affinity purification
Sequenz: PNRCDTIYQGFAECLIRLGDSMGRGGELETICRSWNDFHACASQVLSGCPEEAAAVWESLQQEARQAPRPNNLHTLCGAPVHVRERGTGSETNQETLRATA
Target-Kategorie: NRN1L
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology & Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using NRN1L Rabbit pAb (A16594) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.