SPC24 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16601
Artikelname: SPC24 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16601
Hersteller Artikelnummer: A16601
Alternativnummer: ABB-A16601-20UL,ABB-A16601-100UL,ABB-A16601-1000UL,ABB-A16601-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SPBC24, SPC24
Predicted to be involved in cell division. Located in nucleolus and nucleoplasm. Part of Ndc80 complex.
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 147841
UniProt: Q8NBT2
Reinheit: Affinity purification
Sequenz: MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAKEQVHQGGVELQQLEAGLQEAGEEDTRLKASLLQLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEW
Target-Kategorie: SPC24
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Apoptosis,Cell Cycle. Shipping: Ice Bag
Western blot analysis of lysates from HeLa cells, using SPC24 Rabbit pAb (A16601) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.