CCKAR Rabbit pAb, Polyclonal

Artikelnummer: ABB-A16799
Artikelname: CCKAR Rabbit pAb, Polyclonal
Artikelnummer: ABB-A16799
Hersteller Artikelnummer: A16799
Alternativnummer: ABB-A16799-100UL,ABB-A16799-20UL,ABB-A16799-500UL,ABB-A16799-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Synonym: CCK-A, CCK1R, CCKRA, CCK1-R, CCKAR
This gene encodes a G-protein coupled receptor that binds non-sulfated members of the cholecystokinin (CCK) family of peptide hormones. This receptor is a major physiologic mediator of pancreatic enzyme secretion and smooth muscle contraction of the gallbladder and stomach. In the central and peripheral nervous system this receptor regulates satiety and the release of beta-endorphin and dopamine.
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 886
UniProt: P32238
Reinheit: Affinity purification
Sequenz: IPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLL
Target-Kategorie: CCKAR
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Endocrine Metabolism,Endocrine and metabolic diseases,Obesity,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Dopamine Signaling in Parkinsons Disease. Shipping: Ice Bag
Western blot analysis of various lysates using CCKAR Rabbit pAb (A16799) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.