FGF3 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A16850
Artikelname: FGF3 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A16850
Hersteller Artikelnummer: A16850
Alternativnummer: ABB-A16850-20UL,ABB-A16850-100UL,ABB-A16850-1000UL,ABB-A16850-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Synonym: INT2, HBGF-3, FGF3
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified by its similarity with mouse fgf3/int-2, a proto-oncogene activated in virally induced mammary tumors in the mouse. Frequent amplification of this gene has been found in human tumors, which may be important for neoplastic transformation and tumor progression. Studies of the similar genes in mouse and chicken suggested the role in inner ear formation.
Klonalität: Polyclonal
Molekulargewicht: 27kDa
NCBI: 2248
UniProt: P11487
Reinheit: Affinity purification
Sequenz: MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMN
Target-Kategorie: FGF3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Cell Biology Developmental Biology,Growth factors. Shipping: Ice Bag
Western blot analysis of lysates from Rat liver, using FGF3 Rabbit pAb (A16850) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.