FOXI1 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A16852
Artikelname: FOXI1 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A16852
Hersteller Artikelnummer: A16852
Alternativnummer: ABB-A16852-20UL,ABB-A16852-100UL,ABB-A16852-500UL,ABB-A16852-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Synonym: HFH3, FKH10, HFH-3, FKHL10, FREAC6, FREAC-6, FOXI1
This gene belongs to the forkhead family of transcription factors, which is characterized by a distinct forkhead domain. This gene may play an important role in the development of the cochlea and vestibulum, as well as in embryogenesis. The encoded protein has been found to be required for the transcription of four subunits of a proton pump found in the inner ear, the kidney, and the epididymis. Mutations in this gene have been associated with deafness, autosomal recessive 4.
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 2299
UniProt: Q12951
Reinheit: Affinity purification
Sequenz: MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPNPYLWFNGPTMTPPPYLPGPNASPFLPQAYGVQRPLLPSVS
Target-Kategorie: FOXI1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of various lysates, using FOXI1 Rabbit pAb (A16852) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.