HOXD9 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A16879
Artikelname: HOXD9 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A16879
Hersteller Artikelnummer: A16879
Alternativnummer: ABB-A16879-20UL,ABB-A16879-100UL,ABB-A16879-1000UL,ABB-A16879-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Synonym: HOX4, HOX4C, Hox-4.3, Hox-5.2, HOXD9
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5 end of this cluster have been associated with severe limb and genital abnormalities. The exact role of this gene has not been determined.
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 3235
UniProt: P28356
Reinheit: Affinity purification
Sequenz: VPPPPLAASASEPGRYVRSWMEPLPGFPGGAGGGGGGGGGGPGRGPSPGPSGPANGRHYGIKPETRAAPAPATAASTTSSSSTSLSSSSKRTECSVARESQ
Target-Kategorie: HOXD9
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of lysates from SH-SY5Y cells, using HOXD9 Rabbit pAb (A16879) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.