NAIP Rabbit pAb, Polyclonal

Artikelnummer: ABB-A16924
Artikelname: NAIP Rabbit pAb, Polyclonal
Artikelnummer: ABB-A16924
Hersteller Artikelnummer: A16924
Alternativnummer: ABB-A16924-20UL,ABB-A16924-100UL,ABB-A16924-1000UL,ABB-A16924-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Synonym: BIRC1, NLRB1, psiNAIP, NAIP
This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This copy of the gene is full length, additional copies with truncations and internal deletions are also present in this region of chromosome 5q13. It is thought that this gene is a modifier of spinal muscular atrophy caused by mutations in a neighboring gene, SMN1. The protein encoded by this gene contains regions of homology to two baculovirus inhibitor of apoptosis proteins, and it is able to suppress apoptosis induced by various signals. Alternative splicing and the use of alternative promoters results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 160kDa
NCBI: 4671
UniProt: Q13075
Reinheit: Affinity purification
Sequenz: LLRSIHFPIRGNKTSPRAHFSVLETCFDKSQVPTIDQDYASAFEPMNEWERNLAEKEDNVKSYMDMQRRASPDLSTGYWKLSPKQYKIPCLEVDVNDIDVV
Target-Kategorie: NAIP
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag
Western blot analysis of various lysates using NAIP Rabbit pAb (A16924) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.