TBX6 Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A16979
- Bilder (1)
| Artikelname: | TBX6 Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A16979 |
| Hersteller Artikelnummer: | A16979 |
| Alternativnummer: | ABB-A16979-100UL,ABB-A16979-20UL,ABB-A16979-1000UL,ABB-A16979-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Synonym: | SCDO5, TBX6 |
| This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Knockout studies in mice indicate that this gene is important for specification of paraxial mesoderm structures. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 47kDa |
| NCBI: | 6911 |
| UniProt: | O95947 |
| Reinheit: | Affinity purification |
| Sequenz: | MYHPRELYPSLGAGYRLGPAQPGADSSFPPALAEGYRYPELDTPKLDCFLSGMEAAPRTLAAHPPLPLLPPAMGTEPAPSAPEALHSLPGVSLSLENRELWKEFSSVGTEMIITKAGRRMFPACRVSVTGLDPEARYLFLLDVIPVDGARYRWQGRRWEPSGKAEPRLPDRVYIHPDSPATGAHWMRQPVSFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRAAQLCSQHWGGMASFRFPETTFISVTAYQNP |
| Target-Kategorie: | TBX6 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Stem Cells,Germline Stem Cells,Neural Stem Cells. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using TBX6 Rabbit pAb (A16979) at 1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
