ZNF75A Rabbit pAb, Polyclonal

Artikelnummer: ABB-A17010
Artikelname: ZNF75A Rabbit pAb, Polyclonal
Artikelnummer: ABB-A17010
Hersteller Artikelnummer: A17010
Alternativnummer: ABB-A17010-100UL,ABB-A17010-20UL,ABB-A17010-1000UL,ABB-A17010-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Synonym: ZNF75A
Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in negative regulation of transcription by RNA polymerase II. Predicted to be located in nucleus.
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 7627
UniProt: Q96N20
Reinheit: Affinity purification
Sequenz: WSSDLNKHLTTHQGIKPYKCSWCGKSFSQNTNLHTHQRTHTGEKPFTCHECGKKFSQNSHLIKHRRTHTGEQPYTCSICRRNFSRRSSLLRHQKLHL
Target-Kategorie: ZNF75A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of lysates from A-549 cells, using ZNF75A Rabbit pAb (A17010) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 300s.