LY86 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A17051
Artikelname: LY86 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A17051
Hersteller Artikelnummer: A17051
Alternativnummer: ABB-A17051-100UL,ABB-A17051-20UL,ABB-A17051-1000UL,ABB-A17051-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Synonym: MD1, MD-1, MMD-1, dJ80N2.1, LY86
Acts upstream of or within positive regulation of lipopolysaccharide-mediated signaling pathway. Predicted to be located in extracellular space.
Klonalität: Polyclonal
Molekulargewicht: 18kDa
NCBI: 9450
UniProt: O95711
Reinheit: Affinity purification
Sequenz: DFGFSVEKCSKQLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQVLLELYTEKRS
Target-Kategorie: LY86
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation. Shipping: Ice Bag
Western blot analysis of various lysates using LY86 Rabbit pAb (A17051) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.