CIDEB Rabbit pAb, Polyclonal

Artikelnummer: ABB-A17140
Artikelname: CIDEB Rabbit pAb, Polyclonal
Artikelnummer: ABB-A17140
Hersteller Artikelnummer: A17140
Alternativnummer: ABB-A17140-20UL,ABB-A17140-100UL,ABB-A17140-500UL,ABB-A17140-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Synonym: CIDEB, cell death activator CIDE-B, IN, LHR, MC56, MDU2, MDU3, MIC4, Pgp1, CDW44, CSPG8, HCELL, HUTCH-I, ECMR-III
Enables identical protein binding activity. Involved in activation of cysteine-type endopeptidase activity, positive regulation of cell death, and positive regulation of release of cytochrome c from mitochondria. Acts upstream of or within apoptotic process. Located in cytosol and perinuclear region of cytoplasm.
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 27141
UniProt: Q9UHD4
Reinheit: Affinity purification
Sequenz: DGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLY
Target-Kategorie: CIDEB
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates, using CIDEB Rabbit pAb (A17140) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.