PRR16 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A17155
Artikelname: PRR16 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A17155
Hersteller Artikelnummer: A17155
Alternativnummer: ABB-A17155-20UL,ABB-A17155-100UL,ABB-A17155-500UL,ABB-A17155-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Synonym: DSC54, LARGEN, PRR16
Involved in positive regulation of cell size and positive regulation of translation.
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 51334
UniProt: Q569H4
Reinheit: Affinity purification
Sequenz: PNPPPPPPRLTPVKCEDPKRVVPTANPVKTNGTLLRNGGLPGGPNKIPNGDICCIPNSNLDKAPVQLLMHRPEKDRCPQAGPRERVRFNEKVQYHGYCPDC
Target-Kategorie: PRR16
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using PRR16 Rabbit pAb (A17155) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.