UGT1A6 Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A17165
- Bilder (1)
| Artikelname: | UGT1A6 Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A17165 |
| Hersteller Artikelnummer: | A17165 |
| Alternativnummer: | ABB-A17165-100UL,ABB-A17165-20UL,ABB-A17165-500UL,ABB-A17165-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Synonym: | GNT1, UGT1, HLUGP, UDPGT, UGT1A, UGT1C, UGT1E, UGT1F, HLUGP1, UGT-1A, UGT-1C, UGT-1E, UGT-1F, UGT1.1, UGT1.3, UGT1.5, UGT1.6, UGT1A1, UGT1A3, UGT1A5, UGT1-01, UGT1-03, UGT1-05, UGT1-06, UGT1A6S, hUG-BR1, UDPGT 1-6, UGT1A6 |
| This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5 exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenolic and planar compounds. Alternative splicing in the unique 5 end of this gene results in two transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 61kDa |
| NCBI: | 54578 |
| UniProt: | P19224 |
| Reinheit: | Affinity purification |
| Sequenz: | LLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLYFINCQSLLQDRDTLNFFKESKFDALFTDPALPCGVILAEYLGLPSVYLFRGFPCSLEHTFSRSPDPVSYIPRCYTKFSDHMTFSQRVANFLVNLLEPYLFYCLFSKYEELASAVLKRDVDIITLYQKVSVWLLRYDFVLEYPRPVMPN |
| Target-Kategorie: | UGT1A6 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Drug metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using UGT1A6 Rabbit pAb (A17165) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates / proteins: 25 µg per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time:30s. |
Produktgarantie und fachkundiger Support
