RHOU Rabbit pAb, Polyclonal

Artikelnummer: ABB-A17195
Artikelname: RHOU Rabbit pAb, Polyclonal
Artikelnummer: ABB-A17195
Hersteller Artikelnummer: A17195
Alternativnummer: ABB-A17195-100UL,ABB-A17195-20UL,ABB-A17195-500UL,ABB-A17195-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Synonym: ARHU, G28K, WRCH1, hG28K, CDC42L1, RHOU
This gene encodes a member of the Rho family of GTPases. This protein can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation. A non-coding transcript variant of this gene results from naturally occurring read-through transcription between this locus and the neighboring DUSP5P (dual specificity phosphatase 5 pseudogene) locus.
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 58480
UniProt: Q7L0Q8
Reinheit: Affinity purification
Sequenz: GRAGGAEGRGVKCVLVGDGAVGKTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQ
Target-Kategorie: RHOU
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,MAPK-JNK Signaling Pathway. Shipping: Ice Bag
Western blot analysis of lysates from mouse stomach, using RHOU Rabbit pAb (A17195) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.