ANP32E Rabbit pAb, Polyclonal

Artikelnummer: ABB-A17220
Artikelname: ANP32E Rabbit pAb, Polyclonal
Artikelnummer: ABB-A17220
Hersteller Artikelnummer: A17220
Alternativnummer: ABB-A17220-100UL,ABB-A17220-20UL,ABB-A17220-500UL,ABB-A17220-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Synonym: LANPL, LANP-L, ANP32E
Enables histone binding activity. Involved in histone exchange. Located in nucleus. Part of Swr1 complex.
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 81611
UniProt: Q9BTT0
Reinheit: Affinity purification
Sequenz: MEMKKKINLELRNRSPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARLPSLNKLRKLE
Target-Kategorie: ANP32E
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Caspases,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Neuroscience, Cell Type Marker. Shipping: Ice Bag
Western blot analysis of various lysates using ANP32E Rabbit pAb (A17220) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.