HTR1D Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A1726
Artikelname: HTR1D Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A1726
Hersteller Artikelnummer: A1726
Alternativnummer: ABB-A1726-100UL,ABB-A1726-20UL,ABB-A1726-500UL,ABB-A1726-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HTRL, RDC4, HT1DA, 5-HT1D, HTR1DA, HTR1D
Enables G protein-coupled serotonin receptor activity. Involved in adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway and intestine smooth muscle contraction. Is integral component of plasma membrane.
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 3352
UniProt: P28221
Reinheit: Affinity purification
Sequenz: RTAGHAATMIAIVWAISICISIPPLFWRQAKAQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAG
Target-Kategorie: HTR1D
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Endocrine Metabolism,Endocrine and metabolic diseases,Obesity,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using HTR1D Rabbit pAb (A1726) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.