OLFM3 Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A17293
- Bilder (1)
| Artikelname: | OLFM3 Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A17293 |
| Hersteller Artikelnummer: | A17293 |
| Alternativnummer: | ABB-A17293-100UL,ABB-A17293-20UL,ABB-A17293-1000UL,ABB-A17293-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Alternative Synonym: | B230206G02Rik, OLFM3 |
| Predicted to be involved in eye photoreceptor cell development. Located in Golgi apparatus and extracellular space. Part of AMPA glutamate receptor complex. Is expressed in brain, eye, and head. Orthologous to human OLFM3 (olfactomedin 3). |
| Klonalität: | Polyclonal |
| NCBI: | 229759 |
| Reinheit: | Affinity purification |
| Sequenz: | HQRVLSLETRLRDCMKKLTCGKLMKITGPITVKTSGTRFGAWMTDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAESRTYNLPFKWAGTNHVVYNG |
| Target-Kategorie: | Olfm3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using OLFM3 Rabbit pAb (A17293) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Produktgarantie und fachkundiger Support
