CLEC2B Rabbit pAb, Polyclonal

Artikelnummer: ABB-A17338
Artikelname: CLEC2B Rabbit pAb, Polyclonal
Artikelnummer: ABB-A17338
Hersteller Artikelnummer: A17338
Alternativnummer: ABB-A17338-100UL,ABB-A17338-20UL,ABB-A17338-1000UL,ABB-A17338-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Synonym: AICL, IFNRG1, CLECSF2, HP10085, CLEC2B
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell activation antigen. An alternative splice variant has been described but its full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 9976
UniProt: Q92478
Reinheit: Affinity purification
Sequenz: IGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGS
Target-Kategorie: CLEC2B
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Immunology Inflammation,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling. Shipping: Ice Bag
Western blot analysis of lysates from Rat spleen, using CLEC2B Rabbit pAb (A17338) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.