DOCK1 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A17359
Artikelname: DOCK1 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A17359
Hersteller Artikelnummer: A17359
Alternativnummer: ABB-A17359-20UL,ABB-A17359-100UL,ABB-A17359-500UL,ABB-A17359-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Synonym: ced5, DOCK180, DOCK1
This gene encodes a member of the dedicator of cytokinesis protein family. Dedicator of cytokinesis proteins act as guanine nucleotide exchange factors for small Rho family G proteins. The encoded protein regulates the small GTPase Rac, thereby influencing several biological processes, including phagocytosis and cell migration. Overexpression of this gene has also been associated with certain cancers. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 215kDa
NCBI: 1793
UniProt: B2RUU3
Reinheit: Affinity purification
Sequenz: QTPPPVTPRAKLSFSMQSSLELNGMTGADVADVPPPLPLKGSVADYGNLMENQDLLGSPTPPPPPPHQRHLPPPLPSKTPPPPPPKTTRKQTSVDSGIVQ
Target-Kategorie: DOCK1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of lysates from 293T cells, using DOCK1 Rabbit pAb (A17359) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.