CHRNA5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A1741
- Bilder (1)
| Artikelname: | CHRNA5 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A1741 |
| Hersteller Artikelnummer: | A1741 |
| Alternativnummer: | ABB-A1741-100UL,ABB-A1741-20UL,ABB-A1741-1000UL,ABB-A1741-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LNCR2, CHRNA5 |
| The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. These receptors are thought to be heteropentamers composed of separate but similar subunits. Defects in this gene have been linked to susceptibility to lung cancer type 2 (LNCR2). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 53kDa |
| NCBI: | 1138 |
| UniProt: | P30532 |
| Reinheit: | Affinity purification |
| Sequenz: | RCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYV |
| Target-Kategorie: | CHRNA5 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CHRNA5 Rabbit pAb (A1741) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. |
Produktgarantie und fachkundiger Support
