EN2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17480
Artikelname: EN2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17480
Hersteller Artikelnummer: A17480
Alternativnummer: ABB-A17480-100UL,ABB-A17480-20UL,ABB-A17480-1000UL,ABB-A17480-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: EN2
Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the engrailed (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 2020
UniProt: P19622
Reinheit: Affinity purification
Sequenz: AFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELSLNESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE
Target-Kategorie: EN2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction,Neuroscience,Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using EN2 Rabbit pAb (A17480) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.