EPB42 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A17481
- Bilder (1)
| Artikelname: | EPB42 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A17481 |
| Hersteller Artikelnummer: | A17481 |
| Alternativnummer: | ABB-A17481-20UL,ABB-A17481-100UL,ABB-A17481-500UL,ABB-A17481-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PA, SPH5, EPB42 |
| Erythrocyte membrane protein band 4.2 is an ATP-binding protein which may regulate the association of protein 3 with ankyrin. It probably has a role in erythrocyte shape and mechanical property regulation. Mutations in the EPB42 gene are associated with recessive spherocytic elliptocytosis and recessively transmitted hereditary hemolytic anemia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 77kDa |
| NCBI: | 2038 |
| UniProt: | P16452 |
| Reinheit: | Affinity purification |
| Sequenz: | CDFQAARNNEEHHTKALSSRRLFVRRGQPFTIILYFRAPVRAFLPALKKVALTAQTGEQPSKINRTQATFPISSLGDRKWWSAVVEERDAQSWTISVTTPADAVIGHYSLLLQVSGRKQLLLGQFTLLFNPWNREDAVFLKNEAQRMEYLLNQNGLIYLGTADCIQAESWDFGQFEGDVIDLSLRLLSKDKQVEKWSQPVHVARVLGALLHFLKEQRVLPTPQTQATQEGA |
| Target-Kategorie: | EPB42 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cardiovascular,Blood. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using EPB42 Rabbit pAb (A17481) at 1:800 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 45s. |
Produktgarantie und fachkundiger Support
