PBX3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17514
Artikelname: PBX3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17514
Hersteller Artikelnummer: A17514
Alternativnummer: ABB-A17514-20UL,ABB-A17514-100UL,ABB-A17514-500UL,ABB-A17514-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PBX3
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in animal organ development, neuron development, and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including adult locomotory behavior, dorsal spinal cord development, and regulation of respiratory gaseous exchange by nervous system process. Predicted to be located in nucleus. Predicted to be part of chromatin.
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 5090
UniProt: P40426
Reinheit: Affinity purification
Sequenz: MDDQSRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRGAQE
Target-Kategorie: PBX3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of various lysates using PBX3 Rabbit pAb (A17514) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.