POU3F4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A17521
- Bilder (1)
| Artikelname: | POU3F4 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A17521 |
| Hersteller Artikelnummer: | A17521 |
| Alternativnummer: | ABB-A17521-100UL,ABB-A17521-20UL,ABB-A17521-1000UL,ABB-A17521-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BRN4, DFN3, OTF9, BRN-4, DFNX2, OCT-9, OTF-9, BRAIN-4, POU3F4 |
| This gene encodes a member of the POU-III class of neural transcription factors. This family member plays a role in inner ear development. The protein is thought to be involved in the mediation of epigenetic signals which induce striatal neuron-precursor differentiation. Mutations in this gene are associated with X chromosome-linked nonsyndromic mixed deafness. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 39kDa |
| NCBI: | 5456 |
| UniProt: | P49335 |
| Reinheit: | Affinity purification |
| Sequenz: | MATAASNPYSILSSTSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDHSDEETPT |
| Target-Kategorie: | POU3F4 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from wild type (WT) and 293F cells transfected with POU3F4, using POU3F4 Rabbit pAb (A17521) at 1:2000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 0.5s. |
Produktgarantie und fachkundiger Support
