NMUR1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17610
Artikelname: NMUR1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17610
Hersteller Artikelnummer: A17610
Alternativnummer: ABB-A17610-100UL,ABB-A17610-20UL,ABB-A17610-1000UL,ABB-A17610-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: FM3, FM-3, GPC-R, GPR66, NMU1R, (FM-3), NMUR1
Enables neuromedin U binding activity and neuromedin U receptor activity. Involved in several processes, including activation of phospholipase C activity, chloride transport, and second-messenger-mediated signaling. Is integral component of membrane.
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 10316
UniProt: Q9HB89
Reinheit: Affinity purification
Sequenz: SSRFRETFQEALCLGACCHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQQETDPS
Target-Kategorie: NMUR1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Endocrine Metabolism,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from SGC-7901 cells, using NMUR1 Rabbit pAb (A17610) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.