EXOC3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A17635
- Bilder (1)
| Artikelname: | EXOC3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A17635 |
| Hersteller Artikelnummer: | A17635 |
| Alternativnummer: | ABB-A17635-20UL,ABB-A17635-100UL,ABB-A17635-500UL,ABB-A17635-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SEC6, Sec6p, SEC6L1, EXOC3 |
| The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 86kDa |
| NCBI: | 11336 |
| UniProt: | O60645 |
| Reinheit: | Affinity purification |
| Sequenz: | RKALETDKKDWVKETEPEADQDGYYQTTLPAIVFQMFEQNLQVAAQISEDLKTKVLVLCLQQMNSFLSRYKDEAQLYKEEHLRNRQHPHCYVQYMIAIINNCQTFKESIVSLKRKYLKNEVEEGVSPSQPSMDGILDAIAKEGCSGLLEEVFLDLEQHLNELMTKKWLLGSNAVDIICVTVEDYFNDFAKIKKPYKKRMTAEAHRRVVVEYLRAVMQKRISFRSPEERKEGAEKMVREAEQLRFLFRKLASGFGE |
| Target-Kategorie: | EXOC3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience, Cell Type Marker,Neuron marker,Synapse marker. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using EXOC3 Rabbit pAb (A17635) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 5min. |
Produktgarantie und fachkundiger Support
