ELL2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17645
Artikelname: ELL2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17645
Hersteller Artikelnummer: A17645
Alternativnummer: ABB-A17645-20UL,ABB-A17645-100UL,ABB-A17645-500UL,ABB-A17645-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MRCCAT1, ELL2
Involved in snRNA transcription by RNA polymerase II. Located in nucleoplasm. Part of transcription elongation factor complex.
Klonalität: Polyclonal
Molekulargewicht: 72kDa
NCBI: 22936
UniProt: O00472
Reinheit: Affinity purification
Sequenz: TISQRPYRDRVIHLLALKAYKKPELLARLQKDGVNQKDKNSLGAILQQVANLNSKDLSYTLKDYVFKELQRDWPGYSEIDRRSLESVLSRKLN
Target-Kategorie: ELL2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of lysates from Rat testis, using ELL2 Rabbit pAb (A17645) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.