JAB1/CSN5/COPS5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A1766
- Bilder (1)
| Artikelname: | JAB1/CSN5/COPS5 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A1766 |
| Hersteller Artikelnummer: | A1766 |
| Alternativnummer: | ABB-A1766-100UL,ABB-A1766-20UL,ABB-A1766-1000UL,ABB-A1766-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CSN5, JAB1, SGN5, MOV-34, JAB1/CSN5/COPS5 |
| The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 38kDa |
| NCBI: | 10987 |
| UniProt: | Q92905 |
| Reinheit: | Affinity purification |
| Sequenz: | MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSL |
| Target-Kategorie: | COPS5 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor suppressors,p53 pathway,Cell Biology Developmental Biology,Cell Cycle,Cell cycle inhibitors,Ubiquitin. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using JAB1/CSN5/JAB1/CSN5/COPS5 Rabbit pAb (A1766) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
