PPHLN1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17706
Artikelname: PPHLN1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17706
Hersteller Artikelnummer: A17706
Alternativnummer: ABB-A17706-100UL,ABB-A17706-20UL,ABB-A17706-500UL,ABB-A17706-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CR, HSPC206, HSPC232, PPHLN1
The protein encoded by this gene is one of the several proteins that become sequentially incorporated into the cornified cell envelope during the terminal differentiation of keratinocyte at the outer layers of epidermis. This protein interacts with periplakin, which is known as a precursor of the cornified cell envelope. The cellular localization pattern and insolubility of this protein suggest that it may play a role in epithelial differentiation and contribute to epidermal integrity and barrier formation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.
Klonalität: Polyclonal
Molekulargewicht: 53kDa
NCBI: 51535
UniProt: Q8NEY8
Reinheit: Affinity purification
Sequenz: KSDESNLPEISEYEAGSTAPLFTDQPEEPESNTTHGIELFEDSQLTTRSKAIASKTKEIEQ
Target-Kategorie: PPHLN1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cell Biology Developmental Biology,Cell Cycle,Cell differentiation. Shipping: Ice Bag
Western blot analysis of various lysates using PPHLN1 Rabbit pAb (A17706) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.