TOMM7 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17711
Artikelname: TOMM7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17711
Hersteller Artikelnummer: A17711
Alternativnummer: ABB-A17711-20UL,ABB-A17711-100UL,ABB-A17711-500UL,ABB-A17711-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: TOM7, TOMM7
This gene encodes a subunit of the translocase of the outer mitochondrial membrane. The encoded protein regulates the assembly and stability of the translocase complex.
Klonalität: Polyclonal
Molekulargewicht: 6 kDa
NCBI: 54543
UniProt: Q9P0U1
Reinheit: Affinity purification
Sequenz: MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG
Target-Kategorie: TOMM7
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag
Western blot analysis of lysates from 293F cells, using TOMM7 Rabbit pAb (A17711) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.