NDC1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A17727
- Bilder (1)
| Artikelname: | NDC1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A17727 |
| Hersteller Artikelnummer: | A17727 |
| Alternativnummer: | ABB-A17727-100UL,ABB-A17727-20UL,ABB-A17727-1000UL,ABB-A17727-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NET3, TMEM48, NDC1 |
| A structural constituent of nuclear pore. Involved in nuclear pore complex assembly and nuclear pore localization. Located in actin cytoskeleton, nuclear membrane, and plasma membrane. Part of nuclear pore. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 76kDa |
| NCBI: | 55706 |
| UniProt: | Q9BTX1 |
| Reinheit: | Affinity purification |
| Sequenz: | QYSPSRRQEVFSLSQPGGHPHNWTAISRECLNLLNGMTQKLILYQEAAATNGRVSSSYPVEPKKLNSPEETAFQTPKSSQMPRPSVPPLVKTSLFSSKLSTPDVVSPFGTPFGSSVMNRMAGIFDVNTCYGSPQSPQLIRRGPRLWTSASDQQMTEFSNPSPSTSISAEGKTMRQPSVIYSWIQNKREQIK |
| Target-Kategorie: | NDC1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using NDC1 Rabbit pAb (A17727) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 5min. |
Produktgarantie und fachkundiger Support
