LRRK1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17768
Artikelname: LRRK1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17768
Hersteller Artikelnummer: A17768
Alternativnummer: ABB-A17768-100UL,ABB-A17768-20UL,ABB-A17768-500UL,ABB-A17768-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: OSMD, RIPK6, Roco1, LRRK1
This gene encodes a multi-domain protein that is a leucine-rich repeat kinase and a GDP/GTP binding protein. The encoded protein is thought to play a role in the regulation of bone mass. Mice lacking a similar gene showed severe osteopetrosis, increased bone mineralization and decreased bone resorption.
Klonalität: Polyclonal
Molekulargewicht: 225kDa
NCBI: 79705
UniProt: Q38SD2
Reinheit: Affinity purification
Sequenz: SMYWCVGPEESAVCPERAMETLNGAGDTGGKPSTRGGDPAARSRRTEGIRAAYRRGDRGGARDLLEEACDQCASQLEKGQL
Target-Kategorie: LRRK1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cancer,Signal Transduction,G protein signaling,Small G proteins,Kinase,Endocrine Metabolism,Amino acid metabolism,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from Raji cells, using LRRK1 Rabbit pAb (A17768) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.