NOL10 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17774
Artikelname: NOL10 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17774
Hersteller Artikelnummer: A17774
Alternativnummer: ABB-A17774-100UL,ABB-A17774-20UL,ABB-A17774-500UL,ABB-A17774-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PQBP5, NOL10
Enables RNA binding activity. Predicted to be involved in maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA). Located in nucleolus.
Klonalität: Polyclonal
Molekulargewicht: 80kDa
NCBI: 79954
UniProt: Q9BSC4
Reinheit: Affinity purification
Sequenz: KNSGKIFTSLEPEHDLNDVCLYPNSGMLLTANETPKMGIYYIPVLGPAPRWCSFLDNLTEELEENPESTVYDDYKFVTKKDLENLGLTHLIGSPFLRAYMH
Target-Kategorie: NOL10
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag
Western blot analysis of various lysates using NOL10 Rabbit pAb (A17774) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.