CLVS2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17826
Artikelname: CLVS2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17826
Hersteller Artikelnummer: A17826
Alternativnummer: ABB-A17826-20UL,ABB-A17826-100UL,ABB-A17826-500UL,ABB-A17826-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: RLBP1L2, C6orf212, C6orf213, bA160A10.4, CLVS2
This gene encodes a protein that belongs to the SEC14/CRAL-TRIO family of proteins. A similar protein in rat is thought to function in the endosomal pathway between early endosomes and mature lysosomes.
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 134829
UniProt: Q5SYC1
Reinheit: Affinity purification
Sequenz: LLDHEYDDDSEYNVDSYSMPVKEVEKELSPKSMKRSQSVVDPTVLKRMDKNEEENMQPLLSLD
Target-Kategorie: CLVS2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Signal Transduction. Shipping: Ice Bag
Western blot analysis of various lysates using CLVS2 Rabbit pAb (A17826) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.