CHODL Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17827
Artikelname: CHODL Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17827
Hersteller Artikelnummer: A17827
Alternativnummer: ABB-A17827-20UL,ABB-A17827-100UL,ABB-A17827-1000UL,ABB-A17827-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MT75, PRED12, C21orf68, CHODL
This gene encodes a type I membrane protein with a carbohydrate recognition domain characteristic of C-type lectins in its extracellular portion. In other proteins, this domain is involved in endocytosis of glycoproteins and exogenous sugar-bearing pathogens. This protein localizes predominantly to the perinuclear region. Several transcript variants encoding a few different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 30kDa
NCBI: 140578
UniProt: Q9H9P2
Reinheit: Affinity purification
Sequenz: YRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEINPTAPVEKPYLTNQPGDTHQNVVVTEAGIIPNLIYVVIPTIPLLL
Target-Kategorie: CHODL
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using CHODL Rabbit pAb (A17827) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.