LIN9 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17851
Artikelname: LIN9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17851
Hersteller Artikelnummer: A17851
Alternativnummer: ABB-A17851-100UL,ABB-A17851-20UL,ABB-A17851-1000UL,ABB-A17851-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: TGS, BARA, TGS1, TGS2, Lin-9, BARPsv, LIN9
This gene encodes a tumor suppressor protein that inhibits DNA synthesis and oncogenic transformation through association with the retinoblastoma 1 protein. The encoded protein also interacts with a complex of other cell cycle regulators to repress cell cycle-dependent gene expression in non-dividing cells. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 286826
UniProt: Q5TKA1
Reinheit: Affinity purification
Sequenz: TLGGFPVEFLIQVTRLSKILMIKKEHIKKLREMNTEAEKLKSYSMPISIEFQRRYATIVLELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPC
Target-Kategorie: LIN9
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cell Cycle,Cell cycle inhibitors. Shipping: Ice Bag
Western blot analysis of lysates from Mouse testis, using LIN9 Rabbit pAb (A17851) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.