MSL1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17878
Artikelname: MSL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17878
Hersteller Artikelnummer: A17878
Alternativnummer: ABB-A17878-100UL,ABB-A17878-20UL,ABB-A17878-1000UL,ABB-A17878-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MSL-1, MSL1
Predicted to enable chromatin binding activity. Involved in histone H4-K16 acetylation. Located in nucleoplasm. Part of MSL complex.
Klonalität: Polyclonal
Molekulargewicht: 67kDa
NCBI: 339287
UniProt: Q68DK7
Reinheit: Affinity purification
Sequenz: LAVPSWRDHSVEPLRDPNPSDLLENLDDSVFSKRHAKLELDEKRRKRWDIQRIREQRILQRLQLRMYKKKGIQESEPEVTSFFPEPDDVES
Target-Kategorie: MSL1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using MSL1 Rabbit pAb (A17878) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.