GPR153 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17884
Artikelname: GPR153 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17884
Hersteller Artikelnummer: A17884
Alternativnummer: ABB-A17884-20UL,ABB-A17884-100UL,ABB-A17884-1000UL,ABB-A17884-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PGR1, GPR153
This gene encodes an integral membrane protein that belongs to the Class A rhodopsin superfamily of G protein coupled receptors. The encoded protein is expressed primarily in the central nervous system. A knockdown of the orthologous gene in rat is associated with a significant reduction in food intake and impaired decision making ability. Mutations in this gene are associated with schizophrenia, autism, and other neuropsychiatric disorders. The expression of this gene is activated by the glioma-associated oncogene homolog 1 transcription factor which, in turn, is activated by sonic hedgehog in normal and tumorigenic cells.
Klonalität: Polyclonal
Molekulargewicht: 65kDa
NCBI: 387509
UniProt: Q6NV75
Reinheit: Affinity purification
Sequenz: MSDERRLPGSAVGWLVCGGLSLLANAWGILSVGAKQKKWKPLEFLLCTLAATHMLNVAVPIATYSVVQLRRQRPDFEWNEGLCKVFVSTFYTLTLATCFS
Target-Kategorie: GPR153
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: G protein signaling,G-Protein-Coupled ReceptorsGPCR. Shipping: Ice Bag
Western blot analysis of lysates from Mouse lung, using GPR153 Rabbit pAb (A17884) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.