POU1F1 Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A17976
- Bilder (1)
| Artikelname: | POU1F1 Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A17976 |
| Hersteller Artikelnummer: | A17976 |
| Alternativnummer: | ABB-A17976-20UL,ABB-A17976-100UL,ABB-A17976-1000UL,ABB-A17976-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Synonym: | PIT1, CPHD1, GHF-1, Pit-1, POU1F1a, POU1F1 |
| This gene encodes a member of the POU family of transcription factors that regulate mammalian development. The protein regulates expression of several genes involved in pituitary development and hormone expression. Mutations in this genes result in combined pituitary hormone deficiency. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 33kDa |
| NCBI: | 5449 |
| UniProt: | P28069 |
| Reinheit: | Affinity purification |
| Sequenz: | MDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVK |
| Target-Kategorie: | POU1F1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from wild type (WT) and 293T cells transfected with POU1F1 using POU1F1 Rabbit pAb (A17976) at 1:400 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
