ESRRA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A1798
Artikelname: ESRRA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A1798
Hersteller Artikelnummer: A1798
Alternativnummer: ABB-A1798-100UL,ABB-A1798-20UL,ABB-A1798-500UL,ABB-A1798-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ERR1, ERRa, ESRL1, NR3B1, ERRalpha, ESRRA
The protein encoded by this gene is a nuclear receptor that is most closely related to the estrogen receptor. This protein acts as a site-specific transcription factor and interacts with members of the PGC-1 family of transcription cofactors to regulate the expression of most genes involved in cellular energy production as well as in the process of mitochondrial biogenesis. A processed pseudogene of ESRRA is located on chromosome 13q12.1.
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 2101
UniProt: P11474
Reinheit: Affinity purification
Sequenz: MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAGPGEQGGGKLVLSSLPK
Target-Kategorie: ESRRA
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Nuclear Receptor Signaling,Nuclear hormone receptors,Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Nucleotide metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using ESRRA Rabbit pAb (A1798) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.