FFAR4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A18342
Artikelname: FFAR4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A18342
Hersteller Artikelnummer: A18342
Alternativnummer: ABB-A18342-100UL,ABB-A18342-1000UL,ABB-A18342-500UL,ABB-A18342-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GT01, PGR4, OB10Q, BMIQ10, GPR120, GPR129, O3FAR1, FFAR4
This gene encodes a G protein-coupled receptor (GPR) which belongs to the rhodopsin family of GPRs. The encoded protein functions as a receptor for free fatty acids, including omega-3, and participates in suppressing anti-inflammatory responses and insulin sensitizing. Multiple transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 338557
UniProt: Q5NUL3
Reinheit: Affinity purification
Sequenz: WTEAWLLGPVACHLLFYVMTLSGSVTILTLAAVSLERMVCIVHLQRGVRGPGRRARAVLLALIWGYSAVAALPLCVFFRVVPQRLPGADQEISICTLIWPT
Target-Kategorie: FFAR4
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Endocrine Metabolism,Lipid Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using FFAR4 Rabbit pAb (A18342) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.